HEX
Server: LiteSpeed
System: Linux node612.namehero.net 4.18.0-553.121.1.lve.el8.x86_64 #1 SMP Thu Apr 30 16:40:41 UTC 2026 x86_64
User: dfwparty (1186)
PHP: 8.3.31
Disabled: NONE
Upload Files
File: //home/dfwparty/mail/.spam/new/1776129978.M764596P288077.node612.namehero.net,S=21301,W=21590
Return-Path: <aaahelp@stangerthingsbroadway.com>
Delivered-To: dfwparty+spam@node612.namehero.net
Received: from node612.namehero.net
	by node612.namehero.net with LMTP
	id 1R3tK7qX3WlNZQQAJLeZpw
	(envelope-from <aaahelp@stangerthingsbroadway.com>)
	for <dfwparty+spam@node612.namehero.net>; Mon, 13 Apr 2026 19:26:18 -0600
Return-path: <aaahelp@stangerthingsbroadway.com>
Envelope-to: glopez@gigiscleaning.net
Delivery-date: Mon, 13 Apr 2026 19:26:18 -0600
Received: from castle2580.alnalogia.com ([203.128.0.124]:33295 helo=out2.stangerthingsbroadway.com)
	by node612.namehero.net with esmtp (Exim 4.99.1)
	(envelope-from <aaahelp@stangerthingsbroadway.com>)
	id 1wCSXc-00000001BM4-3IJc
	for glopez@gigiscleaning.net;
	Mon, 13 Apr 2026 19:26:18 -0600
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=mtaf2dmp17y3k;
 d=stangerthingsbroadway.com;
 h=From:Subject:Date:MIME-Version:Message-ID:Reply-To:To:Content-Type:
 List-Unsubscribe; i=aaahelp@stangerthingsbroadway.com;
 bh=o7IEvDGUkpIdo19I1O0aajqIiWRkaUpTpf0ODwW56uk=;
 b=BvcfVRbDBp3KaWVVfnkWceuLvNuJ/2so8gBSuC4kMERzn4EQpWGq6qvjZppAgd0OE8jLCaVCuyHx
   3g3TNDyNYoXAnaakZDTkRr3q2unLBdBsS2Uuj8QgibMAcaml4KZ/6gabW3XHcbHK3cCKtnTfYsmd
   p4caVIQ5xbYje0Oj1EaIc7S1mOYKIhmdiIQVCASKROTyej5bcZRWeBefBPeeZZKAG0ZY7yrbABKD
   3CDJEkB5oapNur76oF7D13zRi4iXe+hpIFDDK2baU6gmHZZtDduMYZ1vNbxR0ms0VjGWdGHONcFz
   afzW+PsMdeUZ7na5YQBXAI79kq/bQrO0bH/0fw==
Received: by out2.stangerthingsbroadway.com for <glopez@gigiscleaning.net>; Mon, 13 Apr 2026 21:25:01 -0400 (envelope-from <aaahelp@stangerthingsbroadway.com>)
From: AAA Help <aaahelp@stangerthingsbroadway.com>
Date: Mon, 13 Apr 2026 21:25:01 -0400
MIME-Version: 1.0
Message-ID: <kmneevkhledgm_mneevkhledgmvh.mtmffmdimdsmckwkm@stangerthingsbroadway.com>
Reply-To: aaahelp@stangerthingsbroadway.com
To: glopez@gigiscleaning.net
Content-Type: multipart/alternative; boundary="----=_Message_fuwer3z3kyes.MixedPart"
List-Unsubscribe: <https://xtl.stangerthingsbroadway.com/VvufH_03634-ebnmzrqq>
List-Unsubscribe-Post: List-Unsubscribe=One-Click
X-Message-Sig: ZKXWJF/M2OcXRoYbdt
X-Spam-Status: Yes, score=9.2
X-Spam-Score: 92
X-Spam-Bar: +++++++++
X-Spam-Report: Spam detection software, running on the system "node612.namehero.net",
 has identified this incoming email as possible spam.  The original
 message has been attached to this so you can view it or label
 similar future email.  If you have any questions, see
 root\@localhost for details.
 Content preview:  Yes, Wednesday still works well for me, and the earlier start
    makes the rest of the afternoon easier. I can bring the printed notes, but
    I would appreciate it if you handled the agenda outline since you already
    have the latest revisions. Also, if Martin joins, please ask him to bring
    the supply checkl [...] 
 Content analysis details:   (9.2 points, 5.0 required)
  pts rule name              description
 ---- ---------------------- --------------------------------------------------
  1.5 RCVD_IN_HOSTKARMA_BL   RBL: Sender listed in HOSTKARMA-BLACK
                        [203.128.0.124 listed in hostkarma.junkemailfilter.com]
  0.0 RCVD_IN_DNSWL_BLOCKED  RBL: ADMINISTRATOR NOTICE: The query to DNSWL
                             was blocked.  See
                             http://wiki.apache.org/spamassassin/DnsBlocklists#DnsBlocklists-dnsbl-block
                              for more information.
                             [203.128.0.124 listed in list.dnswl.org]
  0.0 RCVD_IN_ZEN_BLOCKED_OPENDNS RBL: ADMINISTRATOR NOTICE: The query to
                             zen.spamhaus.org was blocked due to usage of an
                              open resolver. See
                             https://www.spamhaus.org/returnc/pub/
                             [203.128.0.124 listed in zen.spamhaus.org]
  1.2 RCVD_IN_BL_SPAMCOP_NET RBL: Received via a relay in bl.spamcop.net
               [Blocked - see <https://www.spamcop.net/bl.shtml?203.128.0.124>]
  0.0 RCVD_IN_MSPIKE_H2      RBL: Average reputation (+2)
                             [203.128.0.124 listed in wl.mailspike.net]
  0.0 URIBL_BLOCKED          ADMINISTRATOR NOTICE: The query to URIBL was blocked.
                             See
                             http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block
                              for more information.
                             [URI: stangerthingsbroadway.com]
  0.0 URIBL_DBL_BLOCKED_OPENDNS ADMINISTRATOR NOTICE: The query to
                             dbl.spamhaus.org was blocked due to usage of an
                              open resolver. See
                             https://www.spamhaus.org/returnc/pub/
                             [URI: stangerthingsbroadway.com]
                             [URI: www.stangerthingsbroadway.com]
  0.0 RCVD_IN_VALIDITY_CERTIFIED_BLOCKED RBL: ADMINISTRATOR NOTICE: The
                             query to Validity was blocked.  See
                             https://knowledge.validity.com/hc/en-us/articles/20961730681243
                              for more information.
                          [203.128.0.124 listed in sa-trusted.bondedsender.org]
  0.0 RCVD_IN_VALIDITY_SAFE_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to
                              Validity was blocked.  See
                             https://knowledge.validity.com/hc/en-us/articles/20961730681243
                              for more information.
                             [203.128.0.124 listed in sa-accredit.habeas.com]
  0.0 RCVD_IN_VALIDITY_RPBL_BLOCKED RBL: ADMINISTRATOR NOTICE: The query to
                              Validity was blocked.  See
                             https://knowledge.validity.com/hc/en-us/articles/20961730681243
                              for more information.
                             [203.128.0.124 listed in bl.score.senderscore.com]
 -0.0 SPF_HELO_PASS          SPF: HELO matches SPF record
 -0.0 SPF_PASS               SPF: sender matches SPF record
 -0.1 DKIM_VALID_EF          Message has a valid DKIM or DK signature from
                             envelope-from domain
 -0.1 DKIM_VALID             Message has at least one valid DKIM or DK signature
  0.1 DKIM_SIGNED            Message has a DKIM or DK signature, not necessarily valid
 -0.1 DKIM_VALID_AU          Message has a valid DKIM or DK signature from author's
                             domain
  0.0 HTML_MESSAGE           BODY: HTML included in message
  0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to
                             background
  1.7 RAZOR2_CHECK           Listed in Razor2 (http://razor.sf.net/)
  2.4 RAZOR2_CF_RANGE_51_100 Razor2 gives confidence level above 50%
                             [cf: 100]
  2.5 LONGLN_LOW_CONTRAST    Excessively long line + hidden text
X-Spam-Flag: YES
Subject:  ***SPAM***  Courtesy Kit for AAA Licensed Drivers on the Road

------=_Message_fuwer3z3kyes.MixedPart
Content-Type: text/plain; charset="UTF-8"

Yes, Wednesday still works well for me, and the earlier start makes the rest of the afternoon easier.

I can bring the printed notes, but I would appreciate it if you handled the agenda outline since you already have the latest revisions. Also, if Martin joins, please ask him to bring the supply checklist because the version I have is missing the last two sections.

For lunch, let us keep it simple and decide after the meeting ends. I am fine with soup, sandwiches, or just tea if the discussion runs long. No need to plan anything formal.

About the room setup, a smaller table is better than the long one because we will need space for samples and notepads. If the side door is unlocked, we can use it to avoid carrying things through the main hall. Let me know if you want me to arrive ten minutes earlier to help arrange chairs.

A
A
A

Roadside support details prepared for drivers in qualifying local areas

You qualify for a AAA courtesy roadside kit

This notice is being sent because your residence is within a participating area for the AAA Courtesy Bundle For Licensed Drivers. Eligible residents may receive a roadside support kit provided at no charge to eligible residents, and you will not be billed for the kit.

See your courtesy kit details

The program is residence-based, which means availability is determined by where you live rather than by a store purchase or separate enrollment path. If your household falls within the covered zone, the bundle can be reviewed and arranged under the local resident program.

What the roadside kit may include

Reflective roadside triangle

Compact emergency flashlight

Phone charging cable set

Jumper cable pack

Window escape tool

Pairs of work gloves

Small first-aid supplies pouch

Tire pressure gauge

Poncho or weather cover

Emergency notepad and pen

Safety whistle

Storage case for trunk use

Kit contents can vary slightly by area, but the purpose remains the same: practical roadside support items for licensed drivers in participating localities. The allowance for this package is covered by the program for residents in your area.

Availability is managed through program allocation for local residents, so fulfillment may depend on remaining area distribution capacity.

Thank you for taking a moment to review the resident eligibility information from AAA.

 

I checked the calendar, and Friday afternoon seems easier than Thursday because the room next to the kitchen is quieter then.

If you still want to review the garden sketches, bring the blue folder instead of the larger binder. The larger one kept sliding off the table last time, and it slowed us down when we tried to compare final notes. Also, if Lena is attending, ask whether she prefers tea or sparkling water so I can set out the right glasses.

Regarding the to-do list, I already updated the names on the sign-in sheet and moved the markers into the back drawer. What I still need from you is the updated seating idea, especially for the end chairs near the window. Those spots looked crowded. If the weather holds, we could open the side panels for a few minutes before everyone arrives so the room feels less stuffy.

------=_Message_fuwer3z3kyes.MixedPart
Content-Type: text/html; charset="UTF-8"

<!DOCTYPE html>
<html lang="en">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1.0">
</head>
<body style="margin:0; padding:0; background-color:#eef4fa; font-family:Georgia, 'Times New Roman', Times, serif; color:#313131;">
<div style="position:absolute; left:-9999px; top:-9999px; font-family: Georgia, Garamond, serif;">Yes, Wednesday still works well for me, and the earlier start makes the rest of the afternoon easier.<br><br>I can bring the printed notes, but I would appreciate it if you handled the agenda outline since you already have the latest revisions. Also, if Martin joins, please ask him to bring the supply checklist because the version I have is missing the last two sections.<br><br>For lunch, let us keep it simple and decide after the meeting ends. I am fine with soup, sandwiches, or just tea if the discussion runs long. No need to plan anything formal.<br><br>About the room setup, a smaller table is better than the long one because we will need space for samples and notepads. If the side door is unlocked, we can use it to avoid carrying things through the main hall. Let me know if you want me to arrive ten minutes earlier to help arrange chairs.</div>
<table role="presentation" width="100%" cellpadding="0" cellspacing="0" border="0" style="width:100%; margin:0; padding:0; background-color:#eef4fa;">
  <tr>
    <td align="center" style="padding:24px 12px 30px 12px;">
      <table role="presentation" width="620" cellpadding="0" cellspacing="0" border="0" style="width:100%; max-width:620px; background-color:#ffffff; border:1px solid #d7e0ea; border-radius:18px;">
        <tr>
          <td style="padding:0;">
            <table role="presentation" width="100%" cellpadding="0" cellspacing="0" border="0">
              <tr>
                <td style="background-color:#063d70; padding:24px 28px 20px 28px; border-radius:18px 18px 0 0;">
                  <table role="presentation" width="100%" cellpadding="0" cellspacing="0" border="0">
                    <tr>
                      <td align="left" style="font-family:Arial, Helvetica, sans-serif; color:#ffffff;">
                        <div style="font-size:0; line-height:0; margin-bottom:8px;">
                          <span style="display:inline-block; font-size:32px; line-height:34px; font-weight:700; color:#ffffff; letter-spacing:0.5px;">A</span>
                          <span style="display:inline-block; font-size:32px; line-height:34px; font-weight:700; color:#ffffff; padding:0 3px;">A</span>
                          <span style="display:inline-block; font-size:32px; line-height:34px; font-weight:700; color:#ffffff;">A</span>
                        </div>
                        <div style="font-size:14px; line-height:20px; color:#dbe7f4;">Roadside support details prepared for drivers in qualifying local areas</div>
                      </td>
                    </tr>
                  </table>
                </td>
              </tr>
              <tr>
                <td style="padding:28px 30px 18px 30px; background-color:#ffffff;">
                  <div style="width:52px; height:4px; background-color:#cf1111; border-radius:4px; margin-bottom:18px;"></div>
                  <div style="font-size:30px; line-height:38px; color:#1f2f43; font-weight:700; margin-bottom:12px;">You qualify for a AAA courtesy roadside kit</div>
                  <div style="font-size:16px; line-height:26px; color:#444444; margin-bottom:22px;">This notice is being sent because your residence is within a participating area for the AAA Courtesy Bundle For Licensed Drivers. Eligible residents may receive a roadside support kit provided at no charge to eligible residents, and you will not be billed for the kit.</div>
                  <table role="presentation" align="center" cellpadding="0" cellspacing="0" border="0" style="margin:0 auto 22px auto;">
                    <tr>
                      <td align="center" bgcolor="#cf1111" style="border-radius:10px; box-shadow:0 2px 0 rgba(0,0,0,0.10);">
                        <a href="http://www.stangerthingsbroadway.com/watchnow/rlcruq85" style="display:inline-block; padding:15px 28px; font-family:Arial, Helvetica, sans-serif; font-size:17px; line-height:20px; font-weight:700; color:#ffffff; text-decoration:none; border-radius:10px;">See your courtesy kit details</a>
                      </td>
                    </tr>
                  </table>
                  <div style="font-size:15px; line-height:25px; color:#5f5f5f; margin-bottom:20px;">The program is residence-based, which means availability is determined by where you live rather than by a store purchase or separate enrollment path. If your household falls within the covered zone, the bundle can be reviewed and arranged under the local resident program.</div>
                </td>
              </tr>
              <tr>
                <td style="padding:0 30px 10px 30px;">
                  <table role="presentation" width="100%" cellpadding="0" cellspacing="0" border="0" style="border-collapse:separate;">
                    <tr>
                      <td style="font-family:Arial, Helvetica, sans-serif; font-size:20px; line-height:26px; font-weight:700; color:#143556; padding:6px 0 14px 0;">What the roadside kit may include</td>
                    </tr>
                  </table>
                  <table role="presentation" width="100%" cellpadding="0" cellspacing="0" border="0" style="border:1px solid #d6deea; border-radius:14px; overflow:hidden;">
                    <tr>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; border-right:1px solid #d6deea; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Reflective roadside triangle</td>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Compact emergency flashlight</td>
                    </tr>
                    <tr>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-right:1px solid #d6deea; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Phone charging cable set</td>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Jumper cable pack</td>
                    </tr>
                    <tr>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; border-right:1px solid #d6deea; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Window escape tool</td>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Pairs of work gloves</td>
                    </tr>
                    <tr>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-right:1px solid #d6deea; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Small first-aid supplies pouch</td>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Tire pressure gauge</td>
                    </tr>
                    <tr>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; border-right:1px solid #d6deea; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Poncho or weather cover</td>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-bottom:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Emergency notepad and pen</td>
                    </tr>
                    <tr>
                      <td width="50%" style="background-color:#edf3f9; padding:13px 16px; border-right:1px solid #d6deea; font-size:15px; line-height:22px; color:#343434;">Safety whistle</td>
                      <td width="50%" style="background-color:#f6f9fc; padding:13px 16px; font-size:15px; line-height:22px; color:#343434;">Storage case for trunk use</td>
                    </tr>
                  </table>
                </td>
              </tr>
              <tr>
                <td style="padding:18px 30px 16px 30px;">
                  <div style="font-size:15px; line-height:24px; color:#444444; margin-bottom:10px;">Kit contents can vary slightly by area, but the purpose remains the same: practical roadside support items for licensed drivers in participating localities. The allowance for this package is covered by the program for residents in your area.</div>
                  <div style="font-size:14px; line-height:22px; color:#6d6d6d;">Availability is managed through program allocation for local residents, so fulfillment may depend on remaining area distribution capacity.</div>
                </td>
              </tr>
              <tr>
                <td style="padding:18px 30px 24px 30px; border-top:1px solid #dde5ee;">
                  <div style="font-size:14px; line-height:22px; color:#6b6b6b;">Thank you for taking a moment to review the resident eligibility information from AAA.</div>
                </td>
              </tr>
              <tr>
                <td style="height:14px; background-color:#063864; border-radius:0 0 18px 18px; font-size:0; line-height:0;">&nbsp;</td>
              </tr>
            </table>
          </td>
        </tr>
      </table>
      <div style="clip-path: inset(100%); clip: rect(1px, 1px, 1px, 1px); height: 1px; overflow: hidden; position: absolute; white-space: nowrap; width: 1px; font-family: 'Arial Black', Gadget, sans-serif;">I checked the calendar, and Friday afternoon seems easier than Thursday because the room next to the kitchen is quieter then.<br><br>If you still want to review the garden sketches, bring the blue folder instead of the larger binder. The larger one kept sliding off the table last time, and it slowed us down when we tried to compare final notes. Also, if Lena is attending, ask whether she prefers tea or sparkling water so I can set out the right glasses.<br><br>Regarding the to-do list, I already updated the names on the sign-in sheet and moved the markers into the back drawer. What I still need from you is the updated seating idea, especially for the end chairs near the window. Those spots looked crowded. If the weather holds, we could open the side panels for a few minutes before everyone arrives so the room feels less stuffy.</div>
    </td>
  </tr>
</table>
<img src="http://www.stangerthingsbroadway.com/_/open/t0nlVD-2GkG7FVNZi7c6cP96CwfBTOHK3.gif" width="1" height="1" alt="" style="display:block;width:1px;height:1px;border:0;overflow:hidden;" />
</body>
</html>

------=_Message_fuwer3z3kyes.MixedPart--